Protein Info for MIT1002_01699 in Alteromonas macleodii MIT1002

Annotation: Lipoprotein-releasing system transmembrane protein LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 313 to 338 (26 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 3 to 407 (405 residues), 393.4 bits, see alignment E=6e-122 PF12704: MacB_PCD" amino acids 27 to 214 (188 residues), 30.4 bits, see alignment E=4.6e-11 PF02687: FtsX" amino acids 270 to 403 (134 residues), 56.1 bits, see alignment E=3.6e-19

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 87% identity to amc:MADE_02357)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>MIT1002_01699 Lipoprotein-releasing system transmembrane protein LolE (Alteromonas macleodii MIT1002)
MLAFELAQRFRKTRSEQRFISFISMSSTIGIALGCFVLIVLLSVMNGFEKELTSRILSVV
PHGELYSKSESGIENLDAQLYRLSQDSRIASVTPYTGITGMLQSKGELKAISVTGIPVNS
VSDKYAERVTSDEWQRFSTQKNGLIVGKGIFASMDLNIGDIVQILIPQTTQDLTFKAPRS
ITLSISGVLSVGGELDNQLGLMHLETASEAIGISSKSQGIQFTLIDPFSSYETMRDIGYS
YPQAVYMSDWTRTQGHLYNDIQLVRAVVYIALTLVIAVACFNIVSSLVMAVRDKQAAIAI
LKTMGATDRLIRNTFVLQGVINGVIGITVGVVLALLVAPNLSEIVRFIEVAIGIEILSGD
IYFIDFLPSDLHWQDVVVTVVVAMFLSVGATIYPAQKAAKVSPSSALH