Protein Info for MIT1002_01689 in Alteromonas macleodii MIT1002

Annotation: Beta-ketoacyl-acyl-carrier-protein synthase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 1 to 324 (324 residues), 368 bits, see alignment E=1.9e-114 PF08240: ADH_N" amino acids 27 to 110 (84 residues), 55.3 bits, see alignment E=1e-18 PF00107: ADH_zinc_N" amino acids 151 to 275 (125 residues), 91.1 bits, see alignment E=8.7e-30 PF13602: ADH_zinc_N_2" amino acids 184 to 323 (140 residues), 66.6 bits, see alignment E=6.6e-22

Best Hits

KEGG orthology group: None (inferred from 85% identity to amc:MADE_02390)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>MIT1002_01689 Beta-ketoacyl-acyl-carrier-protein synthase I (Alteromonas macleodii MIT1002)
MRYVDFEKGCGPSELVVKECEGLSLAPGKVKVDVKAFGVNRADTLQRQGNYPPPPGESDI
LGLEVAGVVSEVASDVTAFKEGDEVFGLVAGGGYATEVMVNPAHLMPIPKGMPFFEAAGL
AEVFLTAFQCLRTIAHVKPAERALIHGGASGVGLAATQLCRYWGVHSAVTASSQDKLSLC
ESNGAEHLINYKQQQFDDVLKKVWPEGVDMVLDMVGGDYLNRNLKILKQDGKVVYLAMLA
GRYADNLDMAMLLGKRASIIGTTLRNRSDDYKADLIRDFTTVCLPAFENEELRVNIDTHY
SIEDIGEPHVRLENNDTQGKLVLSW