Protein Info for MIT1002_01598 in Alteromonas macleodii MIT1002

Annotation: CAAX amino terminal protease self- immunity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF02517: Rce1-like" amino acids 101 to 191 (91 residues), 50.9 bits, see alignment E=7.8e-18

Best Hits

KEGG orthology group: None (inferred from 91% identity to amc:MADE_02490)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>MIT1002_01598 CAAX amino terminal protease self- immunity (Alteromonas macleodii MIT1002)
MAKLWSELILLFVVIPFAVLYWIKHFANYLMPILGVMGLCCLAILLADKQFKRIKLWHWE
DYRTHLKSTLRLFLPWASLLALVVYFFKPELFLHWPMNQPWMWVATLLIYPLVSVIPQEI
IFRTYFFHRYKRILPSKYARWALSTFLFGLAHLVYGNWIAVVISWIGGGIFGYRYMQTNS
TPVVVIEHAIWGSFLFTIGLGSYLVIAS