Protein Info for MIT1002_01585 in Alteromonas macleodii MIT1002

Annotation: Autoinducer 2 sensor kinase/phosphatase LuxQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 PF00512: HisKA" amino acids 294 to 357 (64 residues), 49.6 bits, see alignment E=5.2e-17 PF02518: HATPase_c" amino acids 405 to 519 (115 residues), 87.6 bits, see alignment E=1.2e-28 PF00072: Response_reg" amino acids 544 to 654 (111 residues), 80.4 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: None (inferred from 83% identity to amc:MADE_02504)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (667 amino acids)

>MIT1002_01585 Autoinducer 2 sensor kinase/phosphatase LuxQ (Alteromonas macleodii MIT1002)
MVYFDEQSSLNVKLEHQLKASLTSLVQRGCDSFGVFQGLLLQLDEETVNILVKASSAYAP
NFKSVPSFSTCVPVDNCFPVNSAKCSTAFKQWFFTYFNAEKYIRGRVHTLDGSQVCLVFI
NACPEQSVNLDKLSLLDDCLSVMLDKFHLEKAETNQNTLYEKLQSVANIGTWEVDLTTNA
LSWSSQTRRIHEVSEDFEPTLETAINFYKEGFDRDEINRIVSHAVATGEPWSATLELVSA
KGNSVWIETHGMAEMKHGKCVRLFGTCQNVNKSVQLRLELEERRREAEAASKERGILLSR
ISHELKTPLNGITGMLQAIKFENKENVRMRKADVALHSADRLLSLINDVLDYTSIINGEF
SLKYSDFCARSLIEDILDVFKTKCVEKGVRLYAVLSFDENTYVHGDAARISQVITNLLSN
AVKFTPKGYISVQVTLKHQGDVPILLASIEDTGVGMSDEILSRIFRPFQNDTASASEELN
GNGLGLSIVNQLVGKMDGELEVRSSAGKGSCFDIAIPVEMAVLNKEKQSDVVLSSDLLSI
PLNVLVVDDNDINRFVLASMLEKFNYLPDEAENGEVAVQMARAKKYDIIFMDCAMPVLDG
VSATKIIVQENLLPKYGRIVAVTANTTPEDKTDCSNAGMADFLAKPVVQNDVTLQVRHAL
KAKSVTA