Protein Info for MIT1002_01580 in Alteromonas macleodii MIT1002

Annotation: Adenine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00962: A_deaminase" amino acids 11 to 330 (320 residues), 305.2 bits, see alignment E=2.7e-95 TIGR01430: adenosine deaminase" amino acids 11 to 329 (319 residues), 370.2 bits, see alignment E=4.2e-115

Best Hits

Swiss-Prot: 59% identical to ADE_ACIAD: Adenine deaminase (ACIAD1245) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 87% identity to amc:MADE_02509)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.4

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>MIT1002_01580 Adenine deaminase (Alteromonas macleodii MIT1002)
MSLSSIIKNIPKAELHLHIEGSLTPELMWRLAEKHSVSLPYVSVEEIEAAYNFEDLQSFL
DLYYAGAGVLRDEDDFFALMWEYLTRCHEDNIVHTEIMFDPQTHTERDIGFDIFMLGFLK
AMEKAKDEYGISSYLIMSFLRHLPEDAAFDTLSAAEPYYEHITAVGLDSSELGHPPSKFE
RVFKKAKALGFKIVAHAGEEGPASYIWEAIELLDVDRIDHGVRCQEDEALMAILKERQIP
LTVCPLSNLKLCVIDDMKDHNIVQLLDAGLLVTVNSDDPTYFGGFLNDNFEALHQSLGID
EKTIRTLVANSFKASFLPQEQKNQLVEKVLSA