Protein Info for MIT1002_01558 in Alteromonas macleodii MIT1002

Annotation: Cyclic di-GMP phosphodiesterase Gmr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 TIGR00229: PAS domain S-box protein" amino acids 37 to 143 (107 residues), 28.3 bits, see alignment E=1.6e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 143 to 306 (164 residues), 155.6 bits, see alignment E=9.9e-50 PF00990: GGDEF" amino acids 147 to 304 (158 residues), 169.5 bits, see alignment E=5.2e-54 PF00563: EAL" amino acids 326 to 559 (234 residues), 224 bits, see alignment E=1.8e-70

Best Hits

KEGG orthology group: None (inferred from 79% identity to amc:MADE_02533)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>MIT1002_01558 Cyclic di-GMP phosphodiesterase Gmr (Alteromonas macleodii MIT1002)
MSLQKYQEPPLFEQHGSAERRFLQLISALPKVSVQGYDKHRKVIYWNKSSEDMYGFRECE
ALGQKLEDLIIPSFMKSEVIKLHQRWIDYGEAIPSDELVLEKKSGEPIHVFSSHVMLKEG
TDSPEMYCVDIDLSEQHNIRQELERMASTDLLTELPNRRLLEQFLTSSIEDASRNKSSFA
LFFIDLDMFKEVNDTLGHTWGDELLRSVSKRLSDCLSEQGLLARFGGDEFVFVATQVTSE
NESADIAKKLTECFKQSFALSTENVHITSSIGISMYPKDGSEIDDLLKNADVAMYQAKAE
GRNRFHFFTHALSQKVRQQRSIAAYLHESLVNDEFELLYQPQIDLLTGKVASCEALLRWR
PKGEDRAVPPNIFIPIAERSELIVHIGNWVLEKACKQAQLWKEQGIDIRVDINVSGKELE
QNAYFERLRECRERHGLMPKDIGLELTENVLIKSDNTILENLRAQRDQGVEISIDDFGTG
YSSLSYLKQFPVSHLKIDRSFLRGAPENAYDSALMEAIVNVGHKLDLNIVVEGVETQNQS
NYCKSLNVEYVQGFLYSKPISSDAIVKLLNEQ