Protein Info for MIT1002_01553 in Alteromonas macleodii MIT1002

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 5 to 143 (139 residues), 222.6 bits, E=3.1e-70
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 13 to 355 (343 residues), 398 bits, E=2.5e-123
• PF00903: Glyoxalase
  • amino acids 160 to 276 (117 residues), 58.1 bits, E=1.8e-19
• PF13669: Glyoxalase_4
  • amino acids 179 to 266 (88 residues), 27.7 bits, E=4.6e-10

Best Hits

Swiss-Prot: 73% identical to HPPD_PSEUJ: 4-hydroxyphenylpyruvate dioxygenase (hpd) from Pseudomonas sp. (strain P.J. 874)

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 98% identity to amc:MADE_02541)

MetaCyc: 73% identical to 4-hydroxyphenylpyruvate dioxygenase subunit (Pseudomonas sp. P.J. 874)
4-hydroxyphenylpyruvate dioxygenase. [EC: 1.13.11.27]

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• L-tyrosine degradation I (4/5 steps found)
• plastoquinol-9 biosynthesis I (1/3 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Protein Sequence (357 amino acids)

>MIT1002_01553 4-hydroxyphenylpyruvate dioxygenase (Alteromonas macleodii MIT1002)
MADLFENPIGLDGFEFLEFTAPKKGMLEPIFEAMGFTLVARHKSKDVELWRQGDINLLSN
YEKKCHAAYYAEEHGPSACGMAFRVKDSQHAYKEVLARGAQPMDTHTGPMELKLPAIKGI
GGAMLYLIDRYEGENTIYDIDFNWIEGVDRHPEGCGFHTLDHLTHNVYRGRMNFWAGFYE
KLFNFREIRYFDIKGEYTGLLSKAMTAPDGKIRIPLNEEAVGGGGQIEEFLMKYNGEGIQ
HIAFACDDLVACLDKLKAKGMKFMTPPPNTYYDMLEERLPGHGENVDELQKRGILLDGTT
ENGEPRLLLQIFSETVFGPVFFEFIQRKQDEGFGEGNFKALFESIERDQVNRGVLNK