Protein Info for MIT1002_01547 in Alteromonas macleodii MIT1002

Annotation: EIICBA-Glc 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00358: PTS_EIIA_1
  • amino acids 20 to 141 (122 residues), 90.5 bits, E=3.7e-30

Best Hits

KEGG orthology group: K02755, PTS system, beta-glucosides-specific IIA component [EC: 2.7.1.69] K02756, PTS system, beta-glucosides-specific IIB component [EC: 2.7.1.69] K02757, PTS system, beta-glucosides-specific IIC component (inferred from 56% identity to alt:ambt_11020)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (166 amino acids)

>MIT1002_01547 EIICBA-Glc 2 (Alteromonas macleodii MIT1002)
MNAKQLQYAPDSFTKRFVTLSPFSGQVVSLSHIDDPYYKSGLMGPGAAISSTSNTVLSPF
AGKVLSVSPLDYAIDIQSSAGLKCKIKYGGDTSHLHGAQFACSLKRSDEIRLKQVLFTVN
AAWLKQRGVSNTCSMTLLNANALIGVVPTHQKFVEAGEDTLLTLYL