Protein Info for MIT1002_01532 in Alteromonas macleodii MIT1002

Annotation: regulatory ATPase RavA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF20030: bpMoxR" amino acids 6 to 176 (171 residues), 29.3 bits, see alignment E=1.6e-10 PF00493: MCM" amino acids 8 to 152 (145 residues), 25 bits, see alignment E=3.3e-09 PF07726: AAA_3" amino acids 35 to 169 (135 residues), 198 bits, see alignment E=1.8e-62 PF07728: AAA_5" amino acids 42 to 167 (126 residues), 40.8 bits, see alignment E=7.7e-14 PF00004: AAA" amino acids 42 to 150 (109 residues), 21.8 bits, see alignment E=7.9e-08 PF17863: AAA_lid_2" amino acids 240 to 294 (55 residues), 55.3 bits, see alignment E=1.6e-18

Best Hits

Swiss-Prot: 43% identical to YEAC_BACSU: Uncharacterized protein YeaC (yeaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 88% identity to amc:MADE_02555)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>MIT1002_01532 regulatory ATPase RavA (Alteromonas macleodii MIT1002)
MRQDIINVQRALSQKIIGKDHQLKLAITCLLANGHLLIEDLPGMGKTTLSHALSQVFGLQ
YSRIQFTSDLLPSDMLGVNIFHSNEQDEAKRFSFRHGPIFSQVVLADELNRASPKTQSAL
LEAMEERQVSIDGVTHALPFPFFVIATQNPSYQSGTYPLPESQLDRFFMRISLGYPAWEA
EKAMLLQQDASAPLAQILNEENLREMQREVAAIHTSDAIIHYILRLVSESRESNDYPNPL
SPRASRAILQGAKAWAFVSGKSYVTPEDVQAVFVAITAHRLTLSSHQLAQGQQTHAFDGE
KLSQKLLDSIDPLAA