Protein Info for MIT1002_01477 in Alteromonas macleodii MIT1002

Annotation: Magnesium and cobalt efflux protein CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF21917: NMB0537_N" amino acids 27 to 62 (36 residues), 37.4 bits, see alignment 2.5e-13 PF00571: CBS" amino acids 67 to 123 (57 residues), 31 bits, see alignment E=4e-11 amino acids 134 to 187 (54 residues), 33.7 bits, see alignment E=5.8e-12 PF03471: CorC_HlyC" amino acids 208 to 281 (74 residues), 67.5 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 58% identical to CORC_VIBCH: Magnesium and cobalt efflux protein CorC (corC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 99% identity to amc:MADE_02233)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>MIT1002_01477 Magnesium and cobalt efflux protein CorC (Alteromonas macleodii MIT1002)
MSDDNPHSTNGSSGKSWLDKLKNSISGEPRSKEELVSVITDAEQNEIIDPQTREMIEGVI
GVNEMRVRDIMIPRAQMTTIDVEQKVEEFLPVMLESAHSRFPVISEDKDHIEGILLAKDL
LAFAFNAEKEFNLRDILRPAVIVPESKRVDVLLKEFRQQRYHMAIVVDEYGGVSGLVTIE
DILEIIVGEIEDEYDTEEDGTDDIRPLNKSTYSVKALTPVDDFNEFFETKFSEEEADTIG
GIVLKAFGHMPETNDEITIGDIQFKVTNSDKRRLIQLKVSVPSLE