Protein Info for MIT1002_01468 in Alteromonas macleodii MIT1002

Annotation: Transcript cleavage factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR01462: transcription elongation factor GreA" amino acids 5 to 156 (152 residues), 198.5 bits, see alignment E=3.1e-63 PF03449: GreA_GreB_N" amino acids 5 to 74 (70 residues), 104.9 bits, see alignment E=2e-34 PF01272: GreA_GreB" amino acids 83 to 157 (75 residues), 101.2 bits, see alignment E=2.4e-33

Best Hits

Swiss-Prot: 77% identical to GREA_HAEIN: Transcription elongation factor GreA (greA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 97% identity to amc:MADE_02242)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>MIT1002_01468 Transcript cleavage factor GreA (Alteromonas macleodii MIT1002)
MSQYPMTARGAQMLRDELNELKTKTRPRIIESIAEAREHGDLKENAEYHAAREQQSFCEG
RIQDIEGKLSNAQIIDVTKMENTGKVIFGTTVTILNVDTDEETTYRIVGDDEADIKNNLI
SVNSPIARGLIGKELDDMVTIQTPAGAVEVEIIEVEYI