Protein Info for MIT1002_01464 in Alteromonas macleodii MIT1002

Annotation: Ni/Fe-hydrogenase, b-type cytochrome subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 7 to 181 (175 residues), 103.7 bits, see alignment E=5.3e-34

Best Hits

KEGG orthology group: None (inferred from 81% identity to amc:MADE_02246)

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>MIT1002_01464 Ni/Fe-hydrogenase, b-type cytochrome subunit (Alteromonas macleodii MIT1002)
MQKTLIWDIPTRLFHWLIVASLLAQYATVEWLENKVQWHFYIGYFTLFLIVFRIIWGFVG
TQHAKFSSFITGPRKVFNYIKTLFNRQSEPAIGHNPLGGWFVVVMLVLLAIQAVSGLFMT
DDIFLDGPYRQLAGEETLALMNTLHHLAFDVLLYVIALHIGAVIFYSVYKKQKLVPAMVH
GNKESATAGITDSRILRAFVVALIAAAAVYVAIEVYPPAPQADEYYY