Protein Info for MIT1002_01451 in Alteromonas macleodii MIT1002

Annotation: fructuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 54 to 76 (23 residues), see Phobius details amino acids 101 to 127 (27 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details amino acids 328 to 352 (25 residues), see Phobius details amino acids 405 to 429 (25 residues), see Phobius details PF02447: GntP_permease" amino acids 5 to 236 (232 residues), 33 bits, see alignment E=2.8e-12 PF03600: CitMHS" amino acids 15 to 341 (327 residues), 33.8 bits, see alignment E=2.1e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_02262)

Predicted SEED Role

"D-beta-hydroxybutyrate permease" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>MIT1002_01451 fructuronate transporter (Alteromonas macleodii MIT1002)
MLSMIGLVGGLLLLIVLTIRGMNLFIAAPLCALVVAITNNIGVFAGDVNFVQTYMSGFSG
FIASWFFMFLLGALFGKFMEDTGAADAVSRWIITKIGYKRAVLAVVLACAILTYGGVSVF
VVAFSVYPMAVSLFKDANLPRRFIPAAMAFGSVTFTMTSAGSPEIQNWIPIKYLGTSPFA
AWEVSLVVAIFMACFGYWWLAKMIRKAVNNGEVFEARASDPEVRDRALPHPLTGIVPLVV
VLVISFLFHEELAQLALILALGGGVLCLLAINYKHFHSLPVAINAGTTGALIAIGNTAAV
VGFGSIAKNTEAFQTTVALMTQIPGNELIGAAIAVSVIAGLTGSASGGQAIALPLVAPHY
LDQGVEPEQLHRIVSISSGALDSLPHNGYVVTTIRAICNETHQAAYWAVGALTVVVPVIG
LAMAIGLFSIM