Protein Info for MIT1002_01448 in Alteromonas macleodii MIT1002

Annotation: D-beta-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 105 to 123 (19 residues), see Phobius details TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 3 to 254 (252 residues), 340.8 bits, see alignment E=2.2e-106 PF23441: SDR" amino acids 3 to 251 (249 residues), 32.5 bits, see alignment E=1.8e-11 PF08659: KR" amino acids 5 to 163 (159 residues), 51.2 bits, see alignment E=4.5e-17 PF00106: adh_short" amino acids 5 to 192 (188 residues), 171.6 bits, see alignment E=4.2e-54 PF01370: Epimerase" amino acids 6 to 234 (229 residues), 34.1 bits, see alignment E=6.1e-12 PF02719: Polysacc_synt_2" amino acids 6 to 103 (98 residues), 23.6 bits, see alignment E=8.4e-09 PF13561: adh_short_C2" amino acids 12 to 253 (242 residues), 176.4 bits, see alignment E=2.2e-55

Best Hits

Swiss-Prot: 43% identical to YXJF_BACSU: Uncharacterized oxidoreductase YxjF (yxjF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 94% identity to amc:MADE_02266)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>MIT1002_01448 D-beta-hydroxybutyrate dehydrogenase (Alteromonas macleodii MIT1002)
MTKRTIFITGGASGIGFGIAESMMKQGHHVIIADINEQAAKEAVTRLAHLDGSASAVAVD
VCDAEQVAALPEVLGKHTVDVLINNAGIQHVSRIEDFPADKWQQLINIMLVGPALLTQAF
LPAMRKQNYGRIINVGSIHSLVASPYKSAYVAAKHGLLGFAKTIALETGDCDVTINTLCP
AYVKTPLVEKQIAAQAKENNLTEEEVITKIMLEPMPKKQFVSVEELADTASFLMSPSARN
ITGQTMVLDGGWTAR