Protein Info for MIT1002_01447 in Alteromonas macleodii MIT1002

Annotation: Lactaldehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 243 to 262 (20 residues), see Phobius details amino acids 282 to 292 (11 residues), see Phobius details PF00465: Fe-ADH" amino acids 8 to 175 (168 residues), 160.4 bits, see alignment E=4.7e-51 PF13685: Fe-ADH_2" amino acids 13 to 108 (96 residues), 42.9 bits, see alignment E=7.8e-15 PF25137: ADH_Fe_C" amino acids 187 to 383 (197 residues), 178.6 bits, see alignment E=1.8e-56

Best Hits

Swiss-Prot: 42% identical to ADH2_ECOLI: Probable alcohol dehydrogenase (yiaY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to amc:MADE_02267)

MetaCyc: 42% identical to L-threonine dehydrogenase (Escherichia coli K-12 substr. MG1655)
L-threonine 3-dehydrogenase. [EC: 1.1.1.103]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1, 1.1.1.103

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>MIT1002_01447 Lactaldehyde reductase (Alteromonas macleodii MIT1002)
MSHQIILPRVMHIGKGASQRVAETLKGLNCHKPLLVTDKVMVELGYSAAIVQVLEEAGIS
ADVFSDTVPEPTVRSIYRGVDAFKTHAYDSIIALGGGSPIDSAKAIAILGKYGGEMRDYK
FPRVVDEAGLPIIAIPTTAGTGSEATRFTIITDEDTTEKMLCVGLGFMPTAALVDYSLTQ
SLPARVTADTGIDALTHAIEAFVSRKANLYSDAQALSAMALIAPNLRTVFADPTNETARE
SMMLGSTLAGIAFSNASVALVHGMSRPIGAAFHVPHGLSNAMLLPAVTAFSIPSASVRYA
QCARAMGVATQSDSDEVANQKLINELKALNADLQVPTPADFGIDKEAFFAETSTMAEQAL
ASGSPGNNPRVPTIEEMVAIYVSLWE