Protein Info for MIT1002_01440 in Alteromonas macleodii MIT1002

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 42 to 68 (27 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details PF04286: DUF445" amino acids 53 to 425 (373 residues), 327 bits, see alignment E=1.4e-101

Best Hits

Swiss-Prot: 38% identical to YJIN_ECOLI: Uncharacterized protein YjiN (yjiN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to amc:MADE_02279)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>MIT1002_01440 putative membrane protein (Alteromonas macleodii MIT1002)
MQDKYTQLNKAKRLALACLIFAASVFVLTVLLPKFYPNLQGVWWLGLIKMASEAALIGGL
ADWFAVTALFKPIPAKYPIPHTNIVASNKSVIANNLSLFVKEKFFHPEAIEKLIRDSDPA
KGAGRWLSQDRNATRLSRFLCDAFAGVLRVLDDKPVKAFIAKTAQKGINQLDLRQLMATS
LSAVTKERQHQVVLDRVLGKLASLLAEPETQIYIADTLVVWLKTEYSRIEKLLPSSWLSE
QGALIAVKAVSSILEDVYEDEHHPIRHAFDEQVHEFLYELQHSPLMEKKVNSYREKIIND
PALNAYVQQSWAKFHQWLLTSLEQQNGKAETKVSSLLNDLGTTLTQDSELAKAFNKHIGE
AAKYMAPDLAEFLTRHIRDTINSWDEREMAEQVELNIGRDLQKVRINGTIVGGLIGAILF
GIEALLGL