Protein Info for MIT1002_01394 in Alteromonas macleodii MIT1002

Annotation: putative ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 146 to 191 (46 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 33 to 308 (276 residues), 141.8 bits, see alignment E=3.5e-45 PF00005: ABC_tran" amino acids 370 to 519 (150 residues), 125.4 bits, see alignment E=2.5e-40

Best Hits

Swiss-Prot: 46% identical to ABCB5_DICDI: ABC transporter B family member 5 (abcB5) from Dictyostelium discoideum

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 92% identity to amc:MADE_02200)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>MIT1002_01394 putative ABC transporter ATP-binding protein (Alteromonas macleodii MIT1002)
MRKNRFPTNVDEPVKWHVLSQLWPYLLEFKHRVFLALLCLVAAKLASIGLPYVLKYTVDS
LNGDLTTLALAVPISLIVAYGTLRLLNVLLGEVRDTLFGRVTERAMRRLGLKVFKHLHNL
DLGFHLNRRTGGLSRDIERGTNGVSFLMRFMVFNIVPTLLEITLVVGLLLFQFGVSFALI
IVVSVVAYIGFSMKATDWRTRFVTQMNEADSTTNSRAVDSLLNFETVKYFNNESFEANRY
DTDLAAWEKARRKNRLSLFALNGGQAAIIAIAMTSMMANAAFGVMNGEMTIGDFVLINAF
TMQIFMPLNFLGFVYREIRGSLANIDKLFDLLAQTPAIKDAHDATELTCANPALRFNNVH
FAYTENRQILNGLSFDVPPGSKVAVVGESGAGKSTLMKLLFRFYEPQQGDITINGKDIAS
VTQQSLRSHIGIVPQDTVLFNTTLLENIRYGNPDASDEDIKQVIKLAHLEAFVESLPEKL
DTTVGERGLKLSGGEKQRVSIARALLKGAPIMIFDEATSSLDSTSERAILAALRDAAEGH
TSLVIAHRLSTIVDADKILVLKNGTIVEEGTHTYLLEQGGEYAALWQAQQREDEDLNENP
KTKGNQ