Protein Info for MIT1002_01381 in Alteromonas macleodii MIT1002

Annotation: Malonyl-CoA O-methyltransferase BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF01209: Ubie_methyltran" amino acids 115 to 246 (132 residues), 34.7 bits, see alignment E=3.6e-12 PF13489: Methyltransf_23" amino acids 146 to 252 (107 residues), 35.6 bits, see alignment E=2.3e-12 PF13847: Methyltransf_31" amino acids 155 to 247 (93 residues), 48.2 bits, see alignment E=2.8e-16 PF13649: Methyltransf_25" amino acids 157 to 245 (89 residues), 68.6 bits, see alignment E=1.9e-22 PF08242: Methyltransf_12" amino acids 158 to 246 (89 residues), 39.5 bits, see alignment E=2.4e-13 PF08241: Methyltransf_11" amino acids 158 to 246 (89 residues), 76.1 bits, see alignment E=8.6e-25

Best Hits

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>MIT1002_01381 Malonyl-CoA O-methyltransferase BioC (Alteromonas macleodii MIT1002)
MSLSPAIKAAMSAESRSLFDGKLSRDAAQAAFKANGAFSSETSFESEKATNAKGTLVAKN
THHPECSFKAEAYVNAEKNAKTEGYVTAEDYVPAEGSKTAKGAAKAERDDTASTINEQDV
AHRFSKAAVQYNSIAGIQRIIAKQALANLPIDLQGTVLDIGCGTGIHTQTLANKGAAATG
VDIAVGMLAQARKMYSDPIFIQGSAVDLPFSDSQFSTVFSSMALQWVSDTGLVAKEVARV
LEKSGIAELAIMVAGSFSELKTARKVAQLPQAETYMPTTAQWVNGFKQSGLSLQRVITKD
YVDTHCNIMSLLRSVKGVGAGETGRKQPPLTRRDIKKLAMAYSNMSGVESKLPLTYRVSH
FRLEKR