Protein Info for MIT1002_01352 in Alteromonas macleodii MIT1002

Annotation: Aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF01118: Semialdhyde_dh" amino acids 5 to 123 (119 residues), 91.2 bits, see alignment E=6.6e-30 TIGR01745: aspartate-semialdehyde dehydrogenase" amino acids 5 to 370 (366 residues), 632.7 bits, see alignment E=8.9e-195 PF02774: Semialdhyde_dhC" amino acids 147 to 357 (211 residues), 163.3 bits, see alignment E=7e-52

Best Hits

Swiss-Prot: 69% identical to DHAS_NEIMA: Aspartate-semialdehyde dehydrogenase (asd) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 95% identity to amc:MADE_02674)

MetaCyc: 68% identical to aspartate-beta-semialdehyde dehydrogenase subunit (Vibrio cholerae)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>MIT1002_01352 Aspartate-semialdehyde dehydrogenase (Alteromonas macleodii MIT1002)
MSQQKVGLVGWRGMVGSVLMQRMQEEQDFAHIEPTFFTTSQKGSAAPDFAGKDAGVLEDA
HDIEALSKQDIIITCQGGDYTKAVYNDLRATGWNGYWIDAASALRMKDDAVIILDPVNRK
EIDSGIEKGIRTYVGGNCTVSLMLLALGGLFEKDLVEWASPMTYQAASGSGAQHMRELIN
QMGAIHSNVKAKVEDPATAILEIDQQVSEFIRSADYPSEQFGVPLAGSLIPYIDSQLPSG
QSREEWKAQAEANKILGIKGSEVPIDGICVRVGAMRCHSQAITLKLKKDLPLAEIETILA
NHNDWVKVIPNDRDATMQELTPAKVTGTLSIPVGRIRKLNMGPEYISAFTVGDQLLWGAA
EPLRRMLRIVLEQK