Protein Info for MIT1002_01337 in Alteromonas macleodii MIT1002

Annotation: cell envelope integrity inner membrane protein TolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 45 to 67 (23 residues), see Phobius details TIGR02794: protein TolA" amino acids 94 to 296 (203 residues), 128.5 bits, see alignment E=1.8e-41 PF06519: TolA" amino acids 203 to 295 (93 residues), 106.8 bits, see alignment E=2.7e-35

Best Hits

KEGG orthology group: K03646, colicin import membrane protein (inferred from 85% identity to amc:MADE_02685)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>MIT1002_01337 cell envelope integrity inner membrane protein TolA (Alteromonas macleodii MIT1002)
MSKPEVSKSTSTASHSNNASNGVSGDKKNGKSAKQANSISPEQVGLYKSIGLHLFIATLL
LISVSFSPDPLPSMPSNAPVIEATFIDAQAIADQKREQAQAEAQARAEEQERQRKAEAAA
EKKRQQQLAAKRAKEKREAEAAEAKRQKDLERLAAQKEQERKEREAKAKAEAERKKKEAA
ERAEMERIMQEQLAKEQAAQQERRRKQVLTEVERYTALIQQTIKRNLYSDDSYQGKTCRL
NIRLATTGFVTSIRVLGGNDALCRAAESAVRRAEKLPVSDAPDVYEQLKDITLKVEL