Protein Info for MIT1002_01330 in Alteromonas macleodii MIT1002

Annotation: Dihydroneopterin triphosphate pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF00293: NUDIX" amino acids 6 to 138 (133 residues), 69.8 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 46% identical to NUDB_SHIFL: Dihydroneopterin triphosphate diphosphatase (nudB) from Shigella flexneri

KEGG orthology group: K08310, dATP pyrophosphohydrolase [EC: 3.6.1.-] (inferred from 94% identity to amc:MADE_01728)

MetaCyc: 46% identical to dihydroneopterin triphosphate diphosphatase (Escherichia coli K-12 substr. MG1655)
3.6.1.M7,3.6.1.9 [EC: 3.6.1.9, 3.6.1.M7]; H2NEOPTERINP3PYROPHOSPHOHYDRO-RXN [EC: 3.6.1.9, 3.6.1.M7, 3.6.1.67]

Predicted SEED Role

"Dihydroneopterin triphosphate pyrophosphohydolase type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.1.9

Use Curated BLAST to search for 3.6.1.- or 3.6.1.67 or 3.6.1.9 or 3.6.1.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>MIT1002_01330 Dihydroneopterin triphosphate pyrophosphatase (Alteromonas macleodii MIT1002)
MAYKKPESALVVLYDQHYRVLLLQRQDDPTFWQSVTGALEEGELPLETAYREVCEEIGID
AKAHGFVVNDHDKQNQYEIRSRWLHRYPPGTVHNTEHVFSLQINSELPIVLTEHLQYEWV
SKDEALARLWSPSNKEAVSLFVPSVP