Protein Info for MIT1002_01295 in Alteromonas macleodii MIT1002

Annotation: Inner membrane protein YpjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 34 to 57 (24 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 39 to 262 (224 residues), 111.7 bits, see alignment E=2e-36

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_01689)

Predicted SEED Role

"FIG001154: CcsA-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>MIT1002_01295 Inner membrane protein YpjD (Alteromonas macleodii MIT1002)
MNTLFAISAALLYALAAAVLIGKFVHQDGPNKRLGLSIASVGAIAHIAFLTNVIIVAPGQ
DMSVTNVLSLVSWIITVSMLIFARAIPNLILLPVVFGFASLTVLASQFIPVSYIMHIELQ
PGLVIHISLSLFAYCTLVIAFLYALQMSYITYRLKQKGAALLHSSLPPLMLVENILFKLL
LAGTCLLTVSLISGFVFLEDMFNKTYAHKTVLSAAALVVFLILLIGQKLRGWRGRQVIVM
TVLGVTLLSLAYFGSKLVREFLL