Protein Info for MIT1002_01282 in Alteromonas macleodii MIT1002

Annotation: VWFA-related Acidobacterial domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details PF01882: DUF58" amino acids 87 to 200 (114 residues), 23.7 bits, see alignment E=4.1e-09 PF00092: VWA" amino acids 90 to 282 (193 residues), 71.6 bits, see alignment E=1.4e-23 PF13519: VWA_2" amino acids 90 to 202 (113 residues), 59.5 bits, see alignment E=7.1e-20

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 89% identity to amc:MADE_02705)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>MIT1002_01282 VWFA-related Acidobacterial domain protein (Alteromonas macleodii MIT1002)
MLNFAWWWVFFVLPLPIIVRLLSKKAQDMPMAALRVPNLRPGDVSEQTQLKQTKIPLLVS
SLIWLLLVTAAARPQWLGEPVSIPNEGREMMLAVDLSGSMKIDDMQLNGRQVNRLTMTKS
VVYEFIQRRVGDRIGLILFADTAYVQAPLTYDRDTVSTLLSEAVIGLVGEQTAIGDAIGL
AVKRFDEREESNNVLILLTDGQNTAGNITPEQAKELAISKGVKVYTIGVGADKMLIQSFF
GSRQINPSQELDEGMLTDIATSTGGQYFRARNAQELQAIYQQLDALEPIEGETRKMRPLS
ALFYYPLGAAILLSALWAFLTVLLSTFRWFAQRRINSSQQPPNSADSIRAAQINRETK