Protein Info for MIT1002_01256 in Alteromonas macleodii MIT1002

Annotation: Nitrogen fixation protein rnfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 6 to 183 (178 residues), 289 bits, see alignment E=6.7e-91 PF04060: FeS" amino acids 47 to 78 (32 residues), 52.4 bits, see alignment 8.6e-18 PF14697: Fer4_21" amino acids 111 to 165 (55 residues), 75.3 bits, see alignment E=8.2e-25 PF00037: Fer4" amino acids 113 to 133 (21 residues), 30 bits, see alignment (E = 8.1e-11) amino acids 142 to 163 (22 residues), 22.9 bits, see alignment (E = 1.4e-08) PF13237: Fer4_10" amino acids 113 to 159 (47 residues), 35.5 bits, see alignment E=1.9e-12

Best Hits

Swiss-Prot: 68% identical to RNFB_AERS4: Ion-translocating oxidoreductase complex subunit B (rnfB) from Aeromonas salmonicida (strain A449)

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 97% identity to amc:MADE_02730)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>MIT1002_01256 Nitrogen fixation protein rnfB (Alteromonas macleodii MIT1002)
MTISTAIIFAVVAIGVLALIFGLVLGYASIRFKVEGDPLVEQIDAVLPQTQCGQCGYPGC
KPYAEAIAEGDDINKCPPGGEATIKKLADLMGVEPKPLDAAHGEEDVKKVAFIREDECIG
CTKCIQACPVDAILGAAKHMHTVITDECTGCDLCVDPCPVDCIDMVPIAQTTSTWKWDFE
SSPKGDIPIKMVS