Protein Info for MIT1002_01190 in Alteromonas macleodii MIT1002

Annotation: Sensor histidine kinase YehU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 165 to 191 (27 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 25 to 193 (169 residues), 199.9 bits, see alignment E=3.6e-63 PF01590: GAF" amino acids 230 to 351 (122 residues), 24 bits, see alignment E=7.7e-09 PF06580: His_kinase" amino acids 367 to 444 (78 residues), 96.7 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 55% identical to BTSS_ECOLI: Sensor histidine kinase BtsS (btsS) from Escherichia coli (strain K12)

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 69% identity to vpa:VP0539)

MetaCyc: 55% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>MIT1002_01190 Sensor histidine kinase YehU (Alteromonas macleodii MIT1002)
MELILSLLQQMCVYLVLAYMLSKTPLFLPILSISSHRKHRYLVYVVFSSFCILGTYFGLQ
IDDAIANTRAIGAVIGGLLGGPVVGFAVGLTGGLHRYSLGGFTDVACAISTTLEGLIGGL
MHVYYVRQNKSLDLFNPWKVGVITFIAELFQMAILLTVAEPFEKSYALVSAIAAPMVIAN
SVGAALFISILSDKKTIFEKYSATFSRRALSIADRSVGVLTSGFTPVNAEKVARIIYEET
NVGAVAITDKEKILAFIGTGADHHLPNTPISSSSTMESLNNNKIVHLDGAERPYQCTLNK
SCPLGSVLIIPLHSGSEVVGTIKLYEPKRKFMSTVTLSMAEGIAQLLSSQIVYGAYQQQK
DLLSQSEIKLLHAQVNPHFLFNALNTISAIIRRDPKRARELVLSLSRFFRINLKQNTAVV
TLKEEIDHVNAYLAIEKARFAERLQVTIKCDDAAMSALLPSFTLQPLVENAVKHGIAQRI
EGGHLTLNVRCTTDNHIHILVEDNAGLYKPKKEQHAGLGMDIVDKRLIHQFGQQAGLVIE
CRTNQFTRMSFSIPHTHYHSHQG