Protein Info for MIT1002_01186 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 83 to 99 (17 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details amino acids 252 to 268 (17 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details PF11168: DUF2955" amino acids 12 to 151 (140 residues), 124.3 bits, see alignment E=3.7e-40 PF13515: FUSC_2" amino acids 192 to 323 (132 residues), 26.4 bits, see alignment E=6.6e-10

Best Hits

KEGG orthology group: None (inferred from 92% identity to amc:MADE_02790)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>MIT1002_01186 hypothetical protein (Alteromonas macleodii MIT1002)
MDSQLSKNDVQQMLRIASGATLGFAISKALDWPNPIFFTLYPILLLGLVAVLNGHIIRQF
LAATIFPAAAVLVVYGLFGSHPLLITPLIAITFAFLFWQMSKGTLYLFGAFSLVGLSLQL
HFASYSSDGIDIYALVISNIGAILLALIIAFALHIVFPDEEPRTPLPKAAKDKASIRHEV
ILCTTVATLSFAVFQTFDLVDSISAQAASVLILFPLCWKGATLSGWQRALGTLIGCNLAL
LAQLILLNYSDTLFFASFSLWILVFFISRQHVLSGGGAGTGFGVLTTFGILYGQSLSPQQ
DIFYSALYRFSSVVVAIALSLCVIYVVHSLLNKFQPTRHHTFT