Protein Info for MIT1002_01166 in Alteromonas macleodii MIT1002

Annotation: biopolymer transport protein ExbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details PF02472: ExbD" amino acids 8 to 130 (123 residues), 108.6 bits, see alignment E=1.2e-35

Best Hits

Swiss-Prot: 52% identical to EXBD2_VIBCH: Biopolymer transport protein exbD2 (exbD2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 100% identity to amc:MADE_02811)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>MIT1002_01166 biopolymer transport protein ExbD (Alteromonas macleodii MIT1002)
MARKVRTEEEDAQIDMTPMLDIVFIMLIFFIVTTVFVKEAGIEVNKPDASQAILHKNANI
FIAVTEDGNVWLDKREVAPDSVRANIERLLTEQPTDYVIIQADVKAKHGLVVEIMDQVKA
AGVNRVSVAARG