Protein Info for MIT1002_01154 in Alteromonas macleodii MIT1002

Annotation: Tryptophan 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03301: Trp_dioxygenase
  • amino acids 9 to 340 (332 residues), 338.1 bits, E=3.6e-105

Best Hits

Swiss-Prot: 95% identical to T23O_ALTMD: Tryptophan 2,3-dioxygenase (kynA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K00453, tryptophan 2,3-dioxygenase [EC: 1.13.11.11] (inferred from 95% identity to amc:MADE_02822)

Predicted SEED Role

"Tryptophan 2,3-dioxygenase (EC 1.13.11.11) homolog" (EC 1.13.11.11)

MetaCyc Pathways

• L-tryptophan degradation I (via anthranilate) (2/3 steps found)
• NAD de novo biosynthesis II (from tryptophan) (5/9 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (2/5 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (2/5 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (7/12 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis I (1/6 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• superpathway of NAD biosynthesis in eukaryotes (5/14 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (7/23 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (9/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.11

Protein Sequence (362 amino acids)

>MIT1002_01154 Tryptophan 2,3-dioxygenase (Alteromonas macleodii MIT1002)
MKKNIEPCYYGDYLQLDKILGAQDLQSEKYGDAAHEEMLFIIVHQVYELWFKQVLHELNA
VIDTFNQETVKDQQLTLVVHRLQRVIQIQKLMNDQIAIMETMTPQQFLSFRDYLVPASGF
QSIQFKRLEISLGLKRDFRIDFDKQSFYNRLTDKDRALLETLESKPSLFELVDKWLSRMP
LLKTEGFDFWQYYKDAAEEMLKDDHHTISTSDMLSDTERRQELKDLQATMENFNALFDDT
QFEKLRGEGKFRLSHKALLSALFIKQYSEEPIFNLPFQLITALTEIDEQLTIWRYRHAMM
VQRMLGTKIGTGGSSGHHYLKKTTESNRIYLDFFNMATFLLPKSALPELPETVRRRLGFY
LQ