Protein Info for MIT1002_01151 in Alteromonas macleodii MIT1002

Annotation: Leucine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF02812: ELFV_dehydrog_N" amino acids 22 to 129 (108 residues), 98.8 bits, see alignment E=3.1e-32 PF00208: ELFV_dehydrog" amino acids 154 to 203 (50 residues), 26.1 bits, see alignment 1e-09 amino acids 221 to 333 (113 residues), 50.7 bits, see alignment E=3e-17

Best Hits

Swiss-Prot: 48% identical to DHLE_BACCR: Leucine dehydrogenase (ldh) from Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)

KEGG orthology group: K00263, leucine dehydrogenase [EC: 1.4.1.9] (inferred from 96% identity to amc:MADE_02824)

Predicted SEED Role

"Leucine dehydrogenase (EC 1.4.1.9)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Degradation and HMG-CoA Metabolism (EC 1.4.1.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>MIT1002_01151 Leucine dehydrogenase (Alteromonas macleodii MIT1002)
MSVFDHPEFNNHEHVAFYHDEKAGLSAIIAVHNTNLGPALGGCRMWPYVNSGEALTDVLR
LSKGMTYKAAMANLELGGGKSVIIGDPRKAKSPEMMKAMGKFVESLGGKYFTAEDSGISV
TDLQTMATESDYIAGVNAKYHYSGEVPDGNPAPSTAYGVFVGLKATVEYGLKRSLDGVSV
AIQGMGHVGYRLAKHLHEHGAKLYVADIYPEGVEKAVSEFGATAVAPEEILSLDVDVLAP
CALGAAINDLSLPEIKAKVIAGAANNQLAREDIGELLQQRGILYAPDYVINAGGVIDIFH
QRMESSSNEALRAHIEQIGETLKEIYTRAEQEGAATNRVANLIAEERFSLKG