Protein Info for MIT1002_01140 in Alteromonas macleodii MIT1002

Annotation: Dipeptide transport system permease protein DppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 238 to 264 (27 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 314 (222 residues), 140 bits, see alignment E=3.9e-45

Best Hits

Swiss-Prot: 42% identical to SAPB_ECOLI: Putrescine export system permease protein SapB (sapB) from Escherichia coli (strain K12)

KEGG orthology group: K12369, dipeptide transport system permease protein (inferred from 94% identity to amc:MADE_02836)

MetaCyc: 42% identical to putrescine ABC exporter membrane subunit SapB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>MIT1002_01140 Dipeptide transport system permease protein DppB (Alteromonas macleodii MIT1002)
MSFSLAYLFPGDTLENLTGLVPQNEIQRAALERQFKLDQPYIFQFFYYVGNLLTGDWGYS
FTSGLPLREEVGIAMPATIELATYAMLMALFIGIPLGYYAGIRSYSTSDHLINSASITTY
SFPVFWFALLLILVFSLQLDAAPLSGRISLLYNIEPVSGFILIDILLSDVENKTLAFKDA
LSHLALPTFAIGAIATASMIRITRRSVIDVKHRPYIAAAISRGLSSWQIFFRHILRNALL
PILPLMAIQITTLITNAMIVETLFSWPGIGNWLIQAIYQRDYPALRIGMMAVSTVVITLT
ILVDLFNRMIDPSREKYERATV