Protein Info for MIT1002_01134 in Alteromonas macleodii MIT1002

Annotation: oxaloacetate decarboxylase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 transmembrane" amino acids 13 to 38 (26 residues), see Phobius details TIGR01195: sodium pump decarboxylases, gamma subunit" amino acids 8 to 100 (93 residues), 47.6 bits, see alignment E=9.9e-17 PF04277: OAD_gamma" amino acids 12 to 97 (86 residues), 57.9 bits, see alignment E=6.7e-20

Best Hits

KEGG orthology group: K01573, oxaloacetate decarboxylase, gamma subunit [EC: 4.1.1.3] (inferred from 33% identity to sbm:Shew185_1091)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>MIT1002_01134 oxaloacetate decarboxylase subunit gamma (Alteromonas macleodii MIT1002)
MNSGSVASLLFEAASLMLIGMVFVFSFLGLLIVGIHLIARFCEAFPGETAEPSAHLKGPS
ANFKGPSANLSRNNQAVQPGIDGNVIAAISAAIHTHRQNSKK