Protein Info for MIT1002_01100 in Alteromonas macleodii MIT1002

Annotation: Flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 241 to 268 (28 residues), see Phobius details amino acids 289 to 304 (16 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 24 to 697 (674 residues), 859.1 bits, see alignment E=1.1e-262 PF00771: FHIPEP" amino acids 31 to 689 (659 residues), 877.5 bits, see alignment E=3.3e-268

Best Hits

Swiss-Prot: 45% identical to FLHA_AQUAE: Flagellar biosynthesis protein FlhA (flhA) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 98% identity to amc:MADE_02873)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (699 amino acids)

>MIT1002_01100 Flagellar biosynthesis protein FlhA (Alteromonas macleodii MIT1002)
MQLSGYLQRFDKNQLQNFTSGLGAPIVLLAIMGMVILPMPPFLLDVLFSFNIALSLVIIL
VAVLTQRPVDFGIFPLVLLIATVLRLALNVASTRVVLLYGHEGGDAAGKVIEAFGEVVIG
GNYAVGIVVFAILLIINFKVVTAGAGRISEVSARFTLDAMPGKQMAIDADLNAGYIDQDQ
ARKRREEITAEADFYGSMDGASKFVKGDAVAGLFIMLINIVGGLFIGMIQHGLSFGNAIE
IYTILTIGDGLVAQIPSLLLSVATAIIVTRENETQEMGKEIRGQLGNNQALYIASGVLFV
MGIIPGMPHIAFLGFSFLIAGFAYWQSVQEKRKAAEPKVPDNVVKDESVAPEVKELGWDD
VQQVDTIGLEVGYRLIPLVDKSQGGELLTRIKGVRKKLSQELGFLIPPVHIRDNLDLEPN
TYTIAMLGVTIGDSIISHDEELAINPGQVFGKLEGRATKDPAFGLDAVWIKPNKREHAQT
LGYTVVDAATVVATHLSQLLSNNAYQLLGHEEAQQLLDMLAKQHPKLVEGLVPDILPLST
VVKVLQTLLFEGVPIRDMRTIVQTLSEYGTRSQDPDVLVSAVRIALKRLIVQEITQGAKE
IPVITLAPELEQMLHQSLQAGGEDGAGIEPGLADKLQKSLQQASQQQELEGEPAVLLTSG
MLRPVLSRFLKYSVVGLHVLSYQEVPDDKQIKIVSSVGQ