Protein Info for MIT1002_01084 in Alteromonas macleodii MIT1002

Annotation: Flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 6 to 110 (105 residues), 63.6 bits, E=1e-21
• PF02049: FliE
  • amino acids 26 to 111 (86 residues), 96.8 bits, E=3.5e-32

Best Hits

Swiss-Prot: 40% identical to FLIE_PSEF5: Flagellar hook-basal body complex protein FliE (fliE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 94% identity to amc:MADE_02890)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Protein Sequence (111 amino acids)

>MIT1002_01084 Flagellar hook-basal body complex protein FliE (Alteromonas macleodii MIT1002)
MDVKANSLYQEMQNMIGQTRLQVNEPQQQPLSEVNSSASDFSTMLKNAVDGVNGMQLESK
DAQQRFEMGDPSLSLAQVMLTKEKAGIAFEATVQVRNKVLEAYKTIMNMPV