Protein Info for MIT1002_01083 in Alteromonas macleodii MIT1002

Annotation: Transcriptional regulatory protein ZraR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00072: Response_reg" amino acids 6 to 114 (109 residues), 97.9 bits, see alignment E=1.8e-31 PF00158: Sigma54_activat" amino acids 133 to 296 (164 residues), 227.5 bits, see alignment E=3.6e-71 PF14532: Sigma54_activ_2" amino acids 144 to 295 (152 residues), 60.4 bits, see alignment E=1.1e-19 PF07724: AAA_2" amino acids 151 to 281 (131 residues), 28.4 bits, see alignment E=7.2e-10 PF07728: AAA_5" amino acids 153 to 272 (120 residues), 28.9 bits, see alignment E=4.8e-10 PF25601: AAA_lid_14" amino acids 302 to 371 (70 residues), 76.3 bits, see alignment E=6.1e-25 PF02954: HTH_8" amino acids 399 to 435 (37 residues), 41.9 bits, see alignment 3.1e-14

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 94% identity to amc:MADE_02891)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>MIT1002_01083 Transcriptional regulatory protein ZraR (Alteromonas macleodii MIT1002)
MSKTTILIVEDDAGLREALLDTLLLGNYEVVAADCAEEALMVLSSRSVDLVVSDIQMGEM
SGLTLLKSIKTKYPNMPVLLMTAYATIDDAVQAMRDGATDYLSKPFAPEVLLNLVGRYAP
AQKIESRTPIVADPSSLKLLELSRKVAKSDATVMVMGPSGSGKEVLSRYIHDQSPRSDAP
FVAINCAAIPENMLEATLFGYEKGAFTGAIQACPGKFEQAQDGTLLLDEITEMDLALQAK
LLRVLQEREVERLGGRKTVKLNVRVIATSNRDLRKAVDAGEFREDLYYRLNVFPIEWRPL
SERPGDIVPLAEHLVQRHASSQGLGTIRLSAAARNKLSQYSWPGNVRELENVVQRALILC
EHNEIDASDLMIDEDMTAPVETPQEHVEDNRLGSELRYQEHQIILDTLVSCNGKRKDVAE
KLGISPRTLRYKLARMREDGIEVPA