Protein Info for MIT1002_01080 in Alteromonas macleodii MIT1002

Annotation: Flagellin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00669: Flagellin_N" amino acids 6 to 135 (130 residues), 89.3 bits, see alignment E=2.6e-29 PF00700: Flagellin_C" amino acids 181 to 265 (85 residues), 52.4 bits, see alignment E=5.6e-18

Best Hits

Swiss-Prot: 36% identical to FLA_BACHD: Flagellin (hag) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K02406, flagellin (inferred from 65% identity to alt:ambt_13315)

Predicted SEED Role

"Flagellin protein FlaA" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>MIT1002_01080 Flagellin (Alteromonas macleodii MIT1002)
MINVGADSVSAQIGQIQQKEDNLFEKLASGKKVNSALDEAAAQQIIDRFTTQVEGNRQAI
KNLYDGISVAQIAEGGLSTINDDVNRIRELSLQSGSGILNDSDRRAIQSEITQLQKNIVQ
SIEQTNFAGKPLLSDAGSLEFQAGVNANQSISVNTQDVAAQLNDVFAIDITSGTSVEDAL
NAADSALESIGGARGEFGASLNRLESTARSLVKGNVNAAEAKSRIESVDYAQAASERAIN
DIRSQASLTVQAQANQQQSQVLSLLS