Protein Info for MIT1002_01079 in Alteromonas macleodii MIT1002

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
  • amino acids 24 to 348 (325 residues), 557.2 bits, E=4.7e-172
• PF04321: RmlD_sub_bind
  • amino acids 30 to 207 (178 residues), 35.3 bits, E=2.7e-12
• PF02719: Polysacc_synt_2
  • amino acids 30 to 302 (273 residues), 348.6 bits, E=1.1e-107
• PF01370: Epimerase
  • amino acids 30 to 214 (185 residues), 78.1 bits, E=3e-25
• PF01073: 3Beta_HSD
  • amino acids 31 to 154 (124 residues), 63 bits, E=9.8e-21
• PF16363: GDP_Man_Dehyd
  • amino acids 31 to 149 (119 residues), 44.4 bits, E=6.3e-15
• PF13460: NAD_binding_10
  • amino acids 34 to 154 (121 residues), 39.1 bits, E=3e-13

Best Hits

Swiss-Prot: 66% identical to PSEB_CAMJE: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 86% identity to alt:ambt_13320)

MetaCyc: 60% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• CMP-pseudaminate biosynthesis (4/6 steps found)
• UDP-N-acetyl-β-L-fucosamine biosynthesis (1/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (1/7 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Protein Sequence (356 amino acids)

>MIT1002_01079 UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (Alteromonas macleodii MIT1002)
MVYGIAADTWYINLRMIKNNGRDMFDGKSILITGGTGSFGHKYTETLLSRYKPKRLIIYS
RDELKQFEMQQKFNAPCMRYFIGDVRDKDRLTRAMQGVDYVIHAAAMKQVPAAEYNPTEC
IRTNIDGAENVINAAIDNEVEKVIALSTDKAANPVNLYGATKLASDKLFVAANNMVGSAR
PRFSVVRYGNVVGSRGSVVPFFQKLIEEGTDHIPVTHKNMTRFWITLQQGVNFVLKNFER
MLGGEIFVPKIPSIRITDLAEAVAPHIPIKIVGIRPGEKLHEMMCPGDMAFHTFEYDDHY
VIAPAIKFYHTDNNYKTNAIGEVGKPVEEGFEYISGANEQFLSMDEIKWLNREANW