Protein Info for MIT1002_01077 in Alteromonas macleodii MIT1002

Annotation: N-acylneuraminate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF02348: CTP_transf_3" amino acids 3 to 226 (224 residues), 104.9 bits, see alignment E=2.9e-34 TIGR03584: pseudaminic acid cytidylyltransferase" amino acids 3 to 223 (221 residues), 286.5 bits, see alignment E=7.1e-90

Best Hits

Swiss-Prot: 45% identical to PSEF_CAMJE: Pseudaminic acid cytidylyltransferase (pseF) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K00983, N-acylneuraminate cytidylyltransferase [EC: 2.7.7.43] (inferred from 49% identity to pwa:Pecwa_3030)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>MIT1002_01077 N-acylneuraminate cytidylyltransferase (Alteromonas macleodii MIT1002)
MNVAIIPARSGSKRITKKNIKMFAGKPIIAYSIENALSCKSIDSVYVSTDSEEISEIAKS
YGATVAFNRPKSLALDTTPTMPVVSHAIKEITQIHPIENVCLLYATAPLINSIDIDNAYQ
QWQQTTKDYIFSVVSYSYPIQRALYKNHNNEIDMVFPDNIVKRSQDFEHVFHDAGTFYWG
TQAAFSYQKPVFSSSSDIYELSRWKAQDIDTVEDWEFAEKLYQVNLLD