Protein Info for MIT1002_01072 in Alteromonas macleodii MIT1002

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF02353: CMAS" amino acids 41 to 128 (88 residues), 33.8 bits, see alignment E=8.3e-12 PF07021: MetW" amino acids 48 to 141 (94 residues), 33.7 bits, see alignment E=1e-11 PF13847: Methyltransf_31" amino acids 50 to 155 (106 residues), 32.5 bits, see alignment E=2.3e-11 PF13649: Methyltransf_25" amino acids 54 to 147 (94 residues), 34 bits, see alignment E=1.4e-11 PF08241: Methyltransf_11" amino acids 55 to 152 (98 residues), 34.5 bits, see alignment E=9.6e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>MIT1002_01072 methionine biosynthesis protein MetW (Alteromonas macleodii MIT1002)
MSIVKVHSKIDKYRELAKSKSLHALSGRANRSDITEFISNYIYDKLNIVDGDRVVDIGCG
DGSLLYKLIDRDVKAIGILPTDEEVLRVQEKFSCFDHININKGLTIDTKLENTSVDKIVC
NGVFIALSTPDEVKKSLNEISRISKPGAKIYIGELPFKNETEGKNYGNSISKWLLWVLKN
QGVIAFMKRYIEVTNAMFSQEPLIIADKKHFFVDEKTFIDWASTFGFNIEICERSKTLVN
NQSRASTSRNDYVFSKVY