Protein Info for MIT1002_01050 in Alteromonas macleodii MIT1002

Annotation: Flagellar hook-associated protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 6 to 321 (316 residues), 175.3 bits, see alignment E=1.4e-55 PF00460: Flg_bb_rod" amino acids 10 to 36 (27 residues), 28.5 bits, see alignment (E = 1.8e-10) PF22638: FlgK_D1" amino acids 87 to 328 (242 residues), 198.8 bits, see alignment E=1.6e-62 PF06429: Flg_bbr_C" amino acids 639 to 677 (39 residues), 38 bits, see alignment 1.4e-13

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 80% identity to amc:MADE_02919)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (680 amino acids)

>MIT1002_01050 Flagellar hook-associated protein 1 (Alteromonas macleodii MIT1002)
MSSVDLFSLATSGVNASSKLLQTTSNNIANVNTPGYVRERTELQNSQVFGVEIGNTERII
NVFAQNQLRRDITSVGELEAFSSKTAAIDNLLASEANSISQGLSEYFAALQTAADDPTNL
ASRDQVLGKSESLYQRMKTLSDYMLEKEEELNLEFTSMVNRANTLIGNIGDLNRNIVIAN
GNNTSDQPSALLNERDQAIDELASIMGITVKESTTQNGAVTINLTSGESLVLENGAFNLF
ELSSNADLTTKEIKLETNFGSQTKNDASIRVVEEDLGGALGGLFRYRNEVLGPTMRDVGQ
LSVAFADAMNTQNKLGMDLDGQIGGNIFDIPFFRGLAYEDTSGDYIVTGQLTEGKGAELT
DADYRIEVMAVSAGVPTQIKVTLLNPDGTPKKDGMGQDIVDPSVAVTAGFAELAGGIEVN
FSGSDAYTVGNEFLIQPAKNVASNIEMATNRPEDLAFANPVRAGADSTNLGSANVIDVTV
SNTEVGTSAFDGAGGLLNSAPAQISFTAADTYEVLDGSGTVLATVMGTTDLTNLISQAGI
SPDPGFDLSLDGVPKAGDSFSISYNTDGFNDNSNALNLAALQNENKVQVSSEATNTPRTF
QDAYASMVGRIGEDASMASVSLASAEAMKVQSQNWFESVSGVSLDEEAANLIKYQQSYAA
AARILSTAQELFNTILQSAR