Protein Info for MIT1002_01048 in Alteromonas macleodii MIT1002

Annotation: Basal body P-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02119: FlgI" amino acids 23 to 369 (347 residues), 451.7 bits, see alignment E=7.7e-140

Best Hits

Swiss-Prot: 98% identical to FLGI_ALTMD: Flagellar P-ring protein (flgI) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 98% identity to amc:MADE_02921)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>MIT1002_01048 Basal body P-ring protein (Alteromonas macleodii MIT1002)
MRLFSVVLAVFTMLLSLQAGAQRIKDVASIQGVRSNQLVGYGLVVGLPGTGEQSPFTEQS
FRTMLRNFGISLDANTKPKIRNVAAVAVHADLPAFAKPGQTIDITVSSVGEAASLQGGTL
LQTFLRGVDGKVYAVAQGSLVVSGFGAQGGDGSRIVVNTPTVGRIPNGAMVEQSVPTGFA
NGDTLTLNLHYPDFSTAKSLADTINERLGAQPENGYVIAKPIDAASVRVSAPRDVGQRVG
FLATLENFEFTPADAPARVVINSRTGTIVIGSDVRLLPAAITHGGLTVTISENQQVSQPN
AFGEGQTAVTTQSIVDVDLADSRMFKFEPGVTLDQLVRAVNEVGAAPGDLMAILEALRQA
GALRGELVII