Protein Info for MIT1002_01043 in Alteromonas macleodii MIT1002

Annotation: Putative proximal rod protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR03506: flagellar hook-basal body protein" amino acids 48 to 165 (118 residues), 108.5 bits, see alignment E=3e-35 PF22692: LlgE_F_G_D1" amino acids 125 to 190 (66 residues), 51.2 bits, see alignment E=1.2e-17 PF06429: Flg_bbr_C" amino acids 242 to 287 (46 residues), 69.2 bits, see alignment 1.6e-23

Best Hits

Swiss-Prot: 44% identical to FLGF_ECOLI: Flagellar basal-body rod protein FlgF (flgF) from Escherichia coli (strain K12)

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 98% identity to amc:MADE_02924)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>MIT1002_01043 Putative proximal rod protein (Alteromonas macleodii MIT1002)
MRPFYFSLYINLIPPLFFNCTKYPQIGTAFAKSCLRFNQSQKSVMDKLLYISASGASQDL
LGTGIRANNLANAQTTGFRAQLEQARSMPAYGEGLPTRVFSMTESPSNNYESGPMIKTDR
DLDVAIQGDGWFAVQDQNGQEAYSRDGNFKLGDDGILTDIHDRVVLGDNGPIFLPVPLDN
LNIAADGTLSMRQLGAPANVIEEVGRLKLVSPNYADMERGNDGLFRMEDGSIAPANANVK
VMSGMLEGSNVNAVDEMVDMISLQRHYELQVKMMKQAEELDTRGNQLLRIL