Protein Info for MIT1002_01036 in Alteromonas macleodii MIT1002

Annotation: flagellar basal body P-ring biosynthesis protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 105 to 237 (133 residues), 119.7 bits, see alignment E=4.5e-39 PF13144: ChapFlgA" amino acids 118 to 236 (119 residues), 103.4 bits, see alignment E=1.3e-33 PF08666: SAF" amino acids 120 to 179 (60 residues), 37.1 bits, see alignment E=5.5e-13

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 90% identity to amc:MADE_02933)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>MIT1002_01036 flagellar basal body P-ring biosynthesis protein FlgA (Alteromonas macleodii MIT1002)
MMKNMNAKTRLTFTRLLSLTVFSVLSMNCLATQTNHKQVEEGAKQYLINQLADNTQDTSI
DVSIVKIDDRINIPDCPTGFEYNASQEALSQSYISVRVSCRNNEWYLFTSGQVTRTKEIV
VTQGAISPGTVLTSSNLSLAKVDVRRLRHTAFTELEALIGARIKRRVTDGQAIQSNMLCF
VCKGDRITITAEVAGMEVKTAGIAQQDGVVGDNIKVINASSQKAVIARVASPEEVVIHL