Protein Info for MIT1002_01010 in Alteromonas macleodii MIT1002

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 2 to 386 (385 residues), 511.8 bits, E=5.5e-158
• PF02670: DXP_reductoisom
  • amino acids 4 to 132 (129 residues), 152.5 bits, E=1.5e-48
• PF08436: DXP_redisom_C
  • amino acids 146 to 235 (90 residues), 125.1 bits, E=1.5e-40
• PF13288: DXPR_C
  • amino acids 267 to 383 (117 residues), 126.1 bits, E=1.3e-40

Best Hits

Swiss-Prot: 57% identical to DXR_DECAR: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 91% identity to amc:MADE_01379)

MetaCyc: 52% identical to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate reductoisomerase. [EC: 1.1.1.267]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Protein Sequence (395 amino acids)

>MIT1002_01010 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Alteromonas macleodii MIT1002)
MQTVTVLGATGSIGCNTLDVINRHPDKYRVFAITGNSQLELLMEQAQKCAPRYVVIADDA
NYKLACELASQYGVDAEILAGVKALEEVSSAPEVDAVMAAIVGAAGLLPTMAAVKAGKRV
LLANKEALVMSGALFIEAANQSGAEILPIDSEHNAIFQCLPHDYEYGNFAASGIRKILLT
GSGGPFRERPLDSFSSITIDEASTHPNWSMGRKITIDSATMMNKGLEFIEACWLFGAGAD
DIDVVIHPQSIIHSMVQYIDGSVIAQMGNPDMRTPIAYGLAHPKRIEAGVTPLDFSDIGN
FSFQTPCFERYPNLKLAIDACKEGQCATTRVNASNEVAVEAFLEGKIEFCDIAKVNDATL
NAMPNVSVNSIQQILEQDSLARAKANEIIRGKFQC