Protein Info for MIT1002_01009 in Alteromonas macleodii MIT1002

Annotation: Phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 12 to 44 (33 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details PF01148: CTP_transf_1" amino acids 3 to 282 (280 residues), 206.9 bits, see alignment E=2.6e-65

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 96% identity to amc:MADE_01378)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>MIT1002_01009 Phosphatidate cytidylyltransferase (Alteromonas macleodii MIT1002)
MLKQRIITALILAPLALYAILFLPIFWFEIAIAGVVGIGAYEWANMSGVCERPKKLIYMA
GAFAICIALSLIVDASTIWYQGQLHGLYRAILTVAVLWWIASLFMVLAYPKYSKFWKDSR
SVRTLFGALTLIPTWVAVVALRTSLHDVDPFYGASLIFYVLGIVWAADIGAFFVGVKFGR
HKLRPNVSPGKSLEGLLGGIAASFAIIAFAALHYQVEPSRIWLHLAIGGITVAVSALGDL
NESMLKRCAGIKDSGKILPGHGGVLDRIDSLTAAFPVFAFCYVTWMA