Protein Info for MIT1002_01007 in Alteromonas macleodii MIT1002

Annotation: Ribosome-releasing factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00496: ribosome recycling factor" amino acids 10 to 185 (176 residues), 241.5 bits, see alignment E=2.1e-76 PF01765: RRF" amino acids 20 to 183 (164 residues), 222.2 bits, see alignment E=1.7e-70

Best Hits

Swiss-Prot: 98% identical to RRF_ALTMD: Ribosome-recycling factor (frr) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02838, ribosome recycling factor (inferred from 98% identity to amc:MADE_01376)

Predicted SEED Role

"Ribosome recycling factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>MIT1002_01007 Ribosome-releasing factor (Alteromonas macleodii MIT1002)
MIDEIELDAQERMEKSLVSLKGQFSKIRTGRAHPSLLDGIMVPYYGVDTPLKQVANVVAE
DSRTLALTVFDKSAIQAVEKAIMQSDLGLNPMSAGGSIRIPLPPLTEERRKDLIRVVRNE
AEGGRVAIRNIRRDANGDIKDLLKEKEISEDESRAAEENIQSITNDFIKKVDSMLADKEK
ELMEV