Protein Info for MIT1002_00973 in Alteromonas macleodii MIT1002

Annotation: Vi polysaccharide export inner membrane protein VexD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 17 to 17 (1 residues), see Phobius details transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K10107, capsular polysaccharide transport system permease protein (inferred from 96% identity to amc:MADE_03061)

Predicted SEED Role

"Capsular polysaccharide export system inner membrane protein KpsE" in subsystem Capsular Polysaccharide (CPS) of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MIT1002_00973 Vi polysaccharide export inner membrane protein VexD (Alteromonas macleodii MIT1002)
MEKSLTQLNALLSKHKMLLLVLPWVLYALYLVLWAAPQYESKSQLIVKSSDGGSSFDPSS
LLMAAGVSGASGGTESQLVEAYIQSADMIKYLDETIGLRDHYMSNKADLFSGLSSSHKQE
DFYQFYLNHIEVSVDSASSVISLRTRAFDAEYAQIINQAIVDKAEEFINNINNNLAKSKL
TFAKGEHEIVEQKLQQAKTEILGFQSKYNVLDPTAEGAAFQQIAFSLEATLAQKKAELST
MSTMMSNVAPEVINIKREIAALQKEVEKQKERISTAEGESEALSVSELMAQYSNLQVQLQ
LAIQAYSSSLITLENARVEAYQKLQHLVTVESPTLPDDNAYPTVIYNLVLFGVSLLLIYG
IVRIVVATIREL