Protein Info for MIT1002_00965 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c-type biogenesis protein CcmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 685 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 250 to 266 (17 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 426 to 444 (19 residues), see Phobius details amino acids 450 to 469 (20 residues), see Phobius details amino acids 498 to 518 (21 residues), see Phobius details amino acids 622 to 642 (21 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 54 to 647 (594 residues), 802.6 bits, see alignment E=1.3e-245 PF01578: Cytochrom_C_asm" amino acids 89 to 296 (208 residues), 177.3 bits, see alignment E=3.3e-56 PF16327: CcmF_C" amino acids 316 to 644 (329 residues), 411.8 bits, see alignment E=2.1e-127

Best Hits

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 96% identity to amc:MADE_03069)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (685 amino acids)

>MIT1002_00965 Cytochrome c-type biogenesis protein CcmF (Alteromonas macleodii MIT1002)
MVPEIGNIALTLALVLSILLAVYPLWGAHRQHEALMATAKPLAIGLFIFTLIAYVCLTYA
FVTDDFSVAYVAQHSNSRLPIYYKITAVWGGHEGSFLLWVLMLSIWTVAVAIFSKGIPLA
MVARVLSVLGLVGIGFYLFMLLTSNPFNSMLPFFPVDGRDLNPLLQDFGMIIHPPMLYMG
YVGFSVAFAFAISALISGQLDSTWARWSRPWVISAWAFLTVGIALGSWWAYYELGWGGWW
FWDPVENASFMPWLVGTALMHSLAVTEKRKAFKSWTVLLAIAAFSLSLLGTFLVRSGVIV
SVHSFASDPTRGLFILGILIVLSGFGLLLYAMRAASLKSPGRYQAFSREVLLMGNNVFLC
AATLVVLLGTLLPLVHKELGLGSISVGAPFFNQMFTLLIVPFVLMLGLGPLTRWKQQKAS
ELQKQLLIAGGIALSAGVLVNFAYDEPTYMGVLGMMLVFWILVTTVQEVMQRLSAMPSSN
SDNTSVLSKLRKLTPSHWGMVLGHVGFAICIIGITLVSNYEMERDVRMDIGDTVSLGGYD
FSFRDVVKVQGPNFEADKGVFDVYQDGELIAHLEPEKRLYIVQRMPMTEAAIHSNLARDL
FIAMGEPLDNGAWAIRIYIKPFVIWLWAGAVVMAIGGIFSISDKRYRMAKVKKIKRVFGG
KSENDAEQSHGQVSTPSNTSVKGGA