Protein Info for MIT1002_00962 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c-type biogenesis protein CcmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 14 to 184 (171 residues), 134.4 bits, see alignment E=2.3e-43 TIGR01191: heme exporter protein CcmC" amino acids 45 to 228 (184 residues), 263.3 bits, see alignment E=6.2e-83

Best Hits

Swiss-Prot: 61% identical to CCMC_HAEIN: Heme exporter protein C (ccmC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02195, heme exporter protein C (inferred from 96% identity to amc:MADE_03072)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>MIT1002_00962 Cytochrome c-type biogenesis protein CcmC (Alteromonas macleodii MIT1002)
MWKWLHPYAKTERAYQLCLTLQPWFWAGALACLSVGTVWGLAFAPQDYQQGDSFRIIYIH
VPSAILSMGTYVAMAIAALVGMVWQWRTAYMSMIAMAPIGAVMTFIALFTGAAWGKPMWG
AWWVWDARLTSELILLFLYMGVIALYGAFEDKQQAGKAAGVMALVGVVNIPIIHYSVEWW
NTLHQGATISKFDNPSIAPEMLWPLLINLLGFAFFIGAVTTVRLRNEIVLREMHRPWVQA
LAMNKALNQQPGDAATASLKEGS