Protein Info for MIT1002_00933 in Alteromonas macleodii MIT1002

Annotation: Inner membrane protein YohK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details amino acids 209 to 235 (27 residues), see Phobius details PF04172: LrgB" amino acids 20 to 232 (213 residues), 226.5 bits, see alignment E=1.3e-71

Best Hits

Swiss-Prot: 34% identical to YOHK_ECOLI: Inner membrane protein YohK (yohK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 81% identity to amc:MADE_03101)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>MIT1002_00933 Inner membrane protein YohK (Alteromonas macleodii MIT1002)
MKEALHQAFSLTGLLWLSVSIIGYIIALWVNKKCKGHPLAHPIVVTALIVSAGLYLTETG
VTEYQQAASLLHWLLGPITVALALPIYRQWQKLKHYGWRLMASIAFGGILAPFTAWLTLF
ALDAPRAIQITMLAKSITTPLAMESSAQVGGIPALAAVFVIVTGVVGAIVATGVFAILNV
QNRQAQGIAMGTVAHAIGTAKAIQMGEDVAAMATLGLCVNGIFTALALPVIFGFFI