Protein Info for MIT1002_00864 in Alteromonas macleodii MIT1002

Annotation: Fructose-bisphosphate aldolase class 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00274: Glycolytic
  • amino acids 19 to 202 (184 residues), 35.4 bits, E=2.7e-13

Best Hits

Swiss-Prot: 63% identical to ALF1_OCEIH: Fructose-bisphosphate aldolase class 1 (fda) from Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] (inferred from 98% identity to amc:MADE_03157)

MetaCyc: 61% identical to class I fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (Synechocystis sp. PCC 6803)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class I (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• gluconeogenesis I (13/13 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• glycolysis I (from glucose 6-phosphate) (12/13 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• glycolysis IV (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• sedoheptulose bisphosphate bypass (2/2 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• oxygenic photosynthesis (12/17 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.13

Protein Sequence (299 amino acids)

>MIT1002_00864 Fructose-bisphosphate aldolase class 1 (Alteromonas macleodii MIT1002)
MASQAQQAMLDKLKTQTGFIAALDQSGGSTPKALRLYGIEESEYSSDEEMFNLVHEMRTR
IITSTPFSGERVLGAILFENTLDREIEGMSSAHFLWQKKRVIPFLKVDKGLAEESNGVQV
MKPMPGLDALLAKAVEQDVFGTKMRSVVKLANHQGIKDVVAQQFEVGKQILAAGLVPIIE
PEVDIHSPQKAEAEALLKLEILTQLNLLNEGQEVMLKLTLPTEANFYKELVDHPRVLKVV
ALSGGYSREEANAKLAENQGIIASFSRALTEGVSAQQTQEEFEATLDTAIEGIYQASKA